PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0146s0044.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 1800aa    MW: 200266 Da    PI: 4.6232
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0146s0044.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.1e-181872357
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                          kR+  t+ qle+Le++++++ryp ++ r+eL+++l+L+++q ++WF+ rR k++k
  Sphfalx0146s0044.1.p 18 KRRMKTPVQLEALERVYAEDRYPVESVRAELSAQLNLSDKQLQMWFCHRRLKDRK 72
                          79999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-141273IPR009057Homeodomain-like
PROSITE profilePS5007115.5161373IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-161478IPR009057Homeodomain-like
SMARTSM003891.4E-151677IPR001356Homeobox domain
CDDcd000862.45E-131874No hitNo description
PfamPF000461.1E-151872IPR001356Homeobox domain
SMARTSM005712.1E-16491550IPR018501DDT domain
PROSITE profilePS5082714.783491550IPR018501DDT domain
PfamPF027911.6E-14493547IPR018501DDT domain
PfamPF050661.3E-13673740IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.3E-7886916IPR028942WHIM1 domain
PfamPF156131.6E-1410631135IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1800 aa     Download sequence    Send to blast
MMASEERMRL SPEETNFKRR MKTPVQLEAL ERVYAEDRYP VESVRAELSA QLNLSDKQLQ  60
MWFCHRRLKD RKGKDEASST PSVSRKKAKV DNSTVLQYPQ AVLASDTGDA VLLSGDHYGQ  120
QYLYEGLQHF TPEEPKARSK RSVPRELEFL GKQRSQELAV RVAVEAQLGE PLREDGPPLG  180
TEFDPLPVGA FSIKGDVLGD PRQFIGQDQS AHGDKHYDYA QEMKLKGSLP SLALGLPPPL  240
PNPRGSKRKS MAPPAPLPVQ FEPRPLCEYQ FLPEQPVRLE ESQFYERATK QLNLFPGPER  300
SYEILAASRM EEARLQKEVE AQEKRIQKEL EKQEALRRKR DEQMRKEQEK MEREIRKEEE  360
RVMRERMKEQ ERIERENKKE AERQEKLQQK ELKRMEKLRH KEEARKEKEA ARIKAANERA  420
LAKRLAKDVT DLIDDEQLEL MEAATAAAAL NHDYLDGDGT LDASQILLRP FPPATVKMKP  480
LLSVYPWTDS DQNVGNLLMV WRFLTTFADV VGLWPFTIDE LVQGFHDYDS RLLADIHVAL  540
VKTMVKDIVD AAQAVAGGTV GQRDAIAMAA GGHPQLVESA YAWGFDIREW GKHVNGLTWP  600
EILRQFALAA GFGPKWKKQN MTSNVSKDEQ EKDKREDTVA NLRSGAAAAN AVALMQGKGI  660
GTSRRSQFCL TPGTVKFAAF HVLSLEGDKG LSIGEVVKRI KTLGLRDLSS SKTPEASVSA  720
VLSRDSNLFE RIAPSTYTVR PAFRKDPEDA DAILSTARER IRQYQIGLLD GKGVEKEGDD  780
ADTEYGSEGQ DVEDMEDMEK EEDEEDEEPG SSKRVKANGR GQRLLTQDGT SGDSESPVAD  840
GNGAVEIEAF EDIVKEDEEE DGGKEGLQGA KPCEQPEDET ELDESQEVEL WVQGLVEGEY  900
ADLSVEERLN ALVALVTTVN QGNAIRVALE ERLEAATALK RQMWAEMQLE KRRLKEEQNS  960
RAHVVPAGPR LEGESPEMLA ENPGAGASTV DPKSVGTIDV NLSNHHVRTQ GDSFAVNGRP  1020
CNGMTSLQSS HEAGSSMAHL SEKSRAQTKV DIGLRAEELY VFRSLPLGCD RRHNRYWQFV  1080
TGNGGQDPGC GRLFFESNSD GCWSVIDNEE DLDALMTSLD PRGAREAALA AILHRLEGTL  1140
RRAMQSKALA DAQQLSRLSS TVTCPFPYGE RGSGWKGLEG SPVSGISGLE SDPVETNAAI  1200
SVELGRTGSE KRRALERYMD VEKWFWSECF NGETATKATK SGLKRDTDLL VSCNVCHDCY  1260
WPQDKHCRCC HATFESSSPR AHSRFLDHNY ECEEKKRRGD PNWKLNGSLA SMPSRLQLLK  1320
AQLLTIELAI PAEALNERWT ERQRKLWAGS LKSASGPSEL LQVLMTLESV VERDWLASTY  1380
ETMEEILEVM GSASCAEGQG AVPHWVPLTT AAVAFRISLF DDALAYDEEA KKDREKQEEE  1440
DEIKEKSQAM HTKVGVPSLR LTPEGLPCDP DEERPRETLE GTTGGKGRNR MASQGVGREK  1500
GGREVKQAGQ VGGRRRSTNN GGAASKSRAR ASSSGPKNSK PKRKLQFVER ETETLVGDGR  1560
QVKAGAGRRC STRTVAGRTG QGGRAPQSGG RSKPAVRSNG RRSQTSTRRP GPKQRNPNEL  1620
MLPVSQRPSK VKLLADSQLP EQDPEEEEEE EEEESNAGGS QAGGHWEASD EGSEDGDPYD  1680
IEENPEIEDD EGREQNGSDT GEGEEEEEER MYDEQAEGDG DELDGNGEED GEDQDEENSY  1740
DAEEAGDDES GQERRDVSDY GRGEIEDEED EETGDIETED EADAKEPEER DSPSYSEED*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001754877.10.0predicted protein
TrEMBLA9RKW70.0A9RKW7_PHYPA; Predicted protein
STRINGPP1S15_37V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.21e-121Homeodomain-like transcriptional regulator